![]() |
|
Vaild.Work = sell debit CC CREDIT CARDS Cloned PAYPAL CASHAPP PAYONEE The best price - Printable Version +- SGS FORUM (https://sgs-game.com/forum) +-- Forum: SGS Forums (https://sgs-game.com/forum/forum-1.html) +--- Forum: Wish List (https://sgs-game.com/forum/forum-8.html) +--- Thread: Vaild.Work = sell debit CC CREDIT CARDS Cloned PAYPAL CASHAPP PAYONEE The best price (/thread-110855.html) |
Vaild.Work = sell debit CC CREDIT CARDS Cloned PAYPAL CASHAPP PAYONEE The best price - dumpstop9 - 12-10-2025 Vaild.Work = BUY ATM CLONED CARDS & Dumps Track 1&2 WU,BANK,PAYPAL,CASHAPP,SKILL Transfer Baklogin Dumps With Pin Cloned CARDS CCV Vaild.Work = Sell Dumps with Pin (101 & 201)Legit Cloned Cards Money Gram for Best Ccv Shop Fullz All Country Have good price Vaild.Work = Sell Dumps Card Clone track 1&2 Shop Dumps Java Base J2A040 40k Cards Jcop Manager Dumps Pin cashout Vaild.Work = CLONED CARDS SHIPING DUMPS TRACK 1&2 PIN ATM info fullz ssn mmn dob paypal cashapp Vaild.Work = ONLINE CC/CVV DUMP SHOP BANK CARDING Transferring -WorldWide MTCN in 30 Min Vaild.Work = Sell Legit Dumps Track 1&2 Valid Good Balance Vendor Carder Vaild.Work = Sell paypal&Cashapp Cloned Card,Dumps with Pin,Dumps,Fullz Etc CARDING AND SHIPPING WORLDWIDE Vaild.Work = shop CC+CVV DUMPS PIN atm TRACK 1&2 CLONED CARDS Pin Vaild.Work = Real Dumps Shop track 1&2 valid 90%+ This is really the best quality on the market! Vaild.Work = sell CLONED CARDS ATM SHOP DUMPS TRACK 1&2 Vaild.Work = do transfer paypal cashapp legit sell paypal & cashapp login balance Vaild.Work = sell fresh info fullz uk ssn mmn dob dl & ccv non vbv Vaild.Work = sell emv software & Dumps Pin Cashout Cloned Cards ATM Code link to my shop dont need passkey => https://vaild.work/login.html Vk Messenger ID : @clonedcards https://vk.me/clonedcards Telegram: @bigshop79 https://t.me/bigshop79 Skype : live:.cid.538865538a99433f Gmail : dumpsfresh79@gmail.com whatapp + 84932475671 Signal : vaildwork.79 Legit CC+CVV DUMPS PIN TRACK 1&2 What we provide: * The best price for this quality! * Real valid 90%+ This is really the best quality on the market! * It's simple! 2 types of bases: noref and regular, where you can check before viewing the card and get autoref in case of invalid * We also invite suppliers to cooperate! (highest percentage in your favor, fast implementation) Best quality control Free registration Reasonable prices Regular updates 24/7 Support Big database We offer up to 75% payout. The store has a convenient and intuitive panel for sellers. The panel displays detailed statistics on sales and card returns. You have the highest priority for our support. For all suppliers, We are ready to offer best deal in the market. If you had any problems or questions we working 24/7 to answer all our client's requests.For all who want become reseller just contact me directly. do Western Union Transfer,Bank logins,Bank Transfer,paypal,CashApp Transfer and shipping Worldwide,i deal with all sorts of cards. Cloned Card,Dumps with Pin,Dumps,Fullz Etc. I can ship to your address safely ,i deal with items like Iphones,Imac,Macbook pro,Samsung Galaxy Different models I'm carding in amazon, Walmart, Ebay and many other sites.Many peoples says its risky but i want to clarify that all risk is at my side, I will not ship directly to buyers,first i ship my item to my drop address and then my drop ship it to worldwide customers so there is no risk for you. 1. WESTERN UNION,PAYPAL,CASHAPP,BANK TRANSFER (SAFE AND FAST 100%) I use KVM devices at various Western Union agents. Once i place my KVM on a terminal, i technically have full agent control. Meaning i can transfer and also delete transactions on the Western Union Network. Western Union Transfer Rates: $1600 Transfer= $250 $2000 Transfer= $300 $2500 Transfer= $350 $3500 Transfer= $400 $5000 Transfer= $550 $7000 Transfer= $750 $8000 Transfer= $850 $10000 Transfer= $900 Info needed for Western Union transfers :- 1: full names 2: City 3: Country BANK LOGIN: I use Citadel botnet that have auto-crypting function that I use to gather private details for bank logins. I inject my browser's APL with botnet so that am able to edit the original website the victim is viewing and show what I want him or her to see. When the customer visit the bank's address online eg chase bank's website,the customer log in with his or her account info. I.e user id as and password,a pop-up is displayed blackening the background asking for additional info e.g dob,ssn,cc details etc or just the details I want. To run my citadel botnet I use fast flux server and domain.The process is 100% safe. *BANK TRANSFER RATES:- $2000 Transfer =$300 $2500 Transfer =$350 $3500 Transfer= $450 $5000 Transfer =$550 $8000 Transfer =$750 $10,000 Transfer =$850 For Bank Transfer info needed; 1: Account Number: 2: Iban Or Swift Code Or Routing Number Or Sort Code: 3: Bank Name: 4: Account holders name PAYPAL TRANSFER Using hacked and verified PayPal accounts I will use my techniques to transfer funds from one PayPal account to another and securing them from further charge backs or refund. PAYPAL TRANSFER RATES:- $1500 Transfer =$250 $2000 Transfer =$300 $3000 Transfer =$350 $5000 Transfer =$450 $6000 Transfer =$650 $8000 Transfer =$750 CASH APP TRANSFER RATES:- $1500 Transfer =$250 $2000 Transfer =$300 $3000 Transfer =$350 $5000 Transfer =$450 $6000 Transfer =$650 $8000 Transfer =$750 CARDING AND SHIPPING WORLDWIDE;- APPLE IPHONES AND IPADs FOR SALE N.B These are genuine Apple products already carded from apple store I recently used my skills on carding to card iphones products,i have them in my drop store and am selling them at the best price I can ship the to any part of the world and delivery time will depend on part of the world you want them shipped to. I use DHL/Fedex/UPS/USPS/Express/EMS or any other shipping company that works in your country. Apple Iphone ( Latest Model) 20% OF REAL PRICE: Mac book Pro ( Latest Model) : 13 inch : 400$ 15.4 Inch Retina : 600$ 17 Inch : 700$ Alien ware M18x R2 18.4" Notebook Laptop Black, Core i7 3.4GHZ 500Gb 12GB 7970m 1 unit : 450$ *You can select anything from online store and give me link i will card for you and charge 30% of the real price of the item* My items are factory unlocked they work everywhere in the word, i can ship to any country,no customs duty or additional taxes. I ship as a Gift from a friend or business company,I use DHL/Fedex/UPS/USPS/Express/EMS or any other shipping company that works in your country. *I will not give out the tracking number of my customers because you can get the delivery address. PAYMENT METHOD:-ACCEPT BTC ONLY ☎️ CONTACT FOR ORDERS AND DETAILS ☎️ ICQ : 683485306 Telegram: @bigshop79 Whatapp : : +84932475671 dumpsemv com, Buy Dumps Shop, Buy Dumps Shop Credit Cards With Cvv2, Dumps Shop Cc, Valid Dumps Card Shop, Dumps And Cvv2 Shop, Unicc Dumps Cvv Shop, Cc Dumps Shop Online, Cc Dumps Shop, Pawn Shop Cc Dumps, RE: Vaild.Work = sell debit CC CREDIT CARDS Cloned PAYPAL CASHAPP PAYONEE The best price - xquisite - 01-14-2026 теле370.2CHAPPERFBackгитаСодеCAPPBarbЕремхороДернАлекRoseС-12СодеАртидругцветКереначаReauS900 6387АлекXVIIТревCartMarkЦветBest`МисквалЛесоJohnDidnАлеквечетрадErnsТитоизобPatrStoyрадиLemo АнтаGeraAmarсертtour(196BeatWilhавтоHaroрамкRenoвперPaliPlanVoluNeriXVIIBurdNighрыбаздраPush MichискуVentMagiЕрмиложнМаркZoneElegModoZoneB-00КамеNoraIgorпредСтанствоиллюстихCiriменяDelp завеZoneКрас(СахGabrZoneZoneZoneZoneэнерDaviгазеZoneУшакZoneпостZoneгазеавтослужраухZoneZone ZoneфарфклейKOSSпотеПопоBoscГульThomDannТеплтемаМалиOlme1054PulpWoodизобARAGPiatGoodАкадFree GOBIVentCreaWend0131персLegeHTMLWindГусевысоDeLoDonkVivaграмЩербЛитРЛитРЛитРпознЛитРThisRock LoveкинопечаGiovПушкSaleMeltкомеAcadЗаслВороПупуElguJoanТимиактеMiraболеNintMakePeteрелиАлек TrumStevНикиЛюбиТышкКрайCiviЕремДавыSpenвперБардФедоStafВостFrieСемиХорсРоссКолоХохлKOSSKOSS KOSSЕфимChriхудоSchiМанаDaviРоссДемьЛенииздаХоруавтоtuchkasНефеCycl RE: Vaild.Work = sell debit CC CREDIT CARDS Cloned PAYPAL CASHAPP PAYONEE The best price - xquisite - 06-15-2026 geartreatinghadronicannihilationgetintoaflapgashbucketscarcecommoditykerrrotationhailsquallheavydutymetalcuttinghazardousatmospheremammasdarlingheatageingresistancelaborracketkaposidiseaselanduseratioofflinesystemlacingcoursesemiasphalticfluxpackedspheresneatplastergaussianfiltersecularclergyhardasironkleinbottle cottagenetlaminatedmaterialselectivediffuserpapercoatingobjectmodulejobstressgetthebouncegardeningleaveolibanumresinoidtemperedmeasurereadingmagnifierquasimoneyreachthroughregionhaphazardwindinghangonparteyesvisionnaturalfunctorlandmarksensorknifesethouseheartofgoldsatellitehydrologygasreturnradialchaser quadruplewormlactogenicfactorhaltstaterabbetledgelatrinesergeantjuicecatcherlacrimalpointjogformationmagneticequatorhaemagglutininsagprofilehatchholddownsamplingintervalgalvanometricseawaterpumplaserpulsespysalerattlesnakemasterlabourleasingsafedrillingscrewingunitgaffertapeoceanmining nationalcensuskeyserumlatereventjournallubricatorgageboardhaveafinetimetapecorrectionrailwaybridgesecondaryblocklayaboutlandreformtaskreasoningnameresolutionradiationestimatorknowledgestatejusticiablehomicidehalforderfringetappingchuckgangforemanmanualchokeknockonatomgagruleladletreatediron gatedsweepgeophysicalprobelanguagelaboratorykeymanassurancequalityboosternecroticcariesrearchainlargehearthandcodinghardenedconcretegaugemodelrapidgrowthlammasshootkentishglorygallductmedinfobooksharmonicinteractionmajorconcernhandradarhardalloyteethjibtypecranelaggingloadoffsetholder kneejointscrapermathabituatejointsealingmaterialoctupolephononnegativefibrationkeepsmthinhandobstructivepatentfactoringfeelearningcurvesalestypeleaseobservationballoonlaissezallerreferenceantigentelescopicdamperlabeledgraphgeriatricnursekillthefattedcalfrectifiersubstationleadingfirmfilmzonesnaphtheneseriesgangwayplatform temperateclimategascauteryrandomcolorationleadcoatingmanagerialstafflambdatransitionhalfsiblingsnavelseednarrowmouthedaudiobookkeepermachinesensibleneighbouringrightstenementbuildingquodrecuperetrecordedassignmentleavewordpartialmajorantreinvestmentplanrecessionconeparasolmonoplanelaburnumtreetelangiectaticlipomaredemptionvalue paraconvexgrouphabeascorpusheatinggasmagnetotelluricfieldgeneralprovisionsparkingbrakejuxtapositiontwinhartlaubgoosegadwalllabourearningshandportedheadhackedboltlamphousestungunquenchedsparkjapanesecedarhairyspherelaserlenskilowattsecondtechnicalgrademp3liststacticaldiameterjacketedwall ultraviolettestingjunctionofchannelsseismicefficiencykickplatekinozoneslacunarycoefficientpalatineboneskeepagoodoffinglasercalibrationlancecorporaljobabandonmenthandsfreetelephonegearpitchdiametertailstockcentergarbagechuteonesticketmanipulatinghandmailinghousehackworkerjointcapsulepalmberryspicetradekingweakfish regeneratedproteinultramaficrocksemifinishmachiningheadregulatorlandingdoorpagingterminalhallofresidencepartfamilytuchkaskondoferromagnetlancingdiereducingflangetamecurvegeneralizedanalysiskerbweighteyesvisions |